Lineage for d3esja_ (3esj A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914817Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 1914818Family d.79.5.1: IpsF-like [69766] (3 proteins)
    automatically mapped to Pfam PF02542
  6. 1914819Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)
  7. 1914820Species Escherichia coli K-12 [TaxId:83333] [188969] (5 PDB entries)
  8. 1914830Domain d3esja_: 3esj A: [175193]
    automated match to d1h48c_
    complexed with cc7, gpp, mg, zn

Details for d3esja_

PDB Entry: 3esj (more details), 2.7 Å

PDB Description: Crystal structure of 2C-methyl-D-erythritol 2,4-clycodiphosphate synthase complexed with ligand
PDB Compounds: (A:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d3esja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3esja_ d.79.5.1 (A:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli K-12 [TaxId: 83333]}
mlemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdi
gklfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfia
edlgchmddvnvkattteklgftgrgegiaceavallikatk

SCOPe Domain Coordinates for d3esja_:

Click to download the PDB-style file with coordinates for d3esja_.
(The format of our PDB-style files is described here.)

Timeline for d3esja_: