Lineage for d3elgb_ (3elg B:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.98: BLIP-like [55647] (2 superfamilies)
alpha(2)-beta(4); 2 layers: alpha/beta
Superfamily d.98.2: BT0923-like [160574] (2 families) 
Duplication: tandem repeat of two similar structural subdomains, which associate like the BLIP repeats but differ from them by transposition of the helicesFamily d.98.2.1: BT0923-like [160575] (3 proteins)
after putative calcium-regulated periplasmic protein BT0923 (PDB ID 3DUE; new)
Protein Putative periplasmic protein BVU2443 [160576] (1 species) Species Bacteroides vulgatus [TaxId:821] [160577] (1 PDB entry)
Uniprot A6L337 20-146
Domain d3elgb_: 3elg B: [158183]
automated match to d3elga1
complexed with cit
Details for d3elgb_
PDB Entry: 3elg (more details), 1.64 Å
PDB Description: crystal structure of a putative periplasmic protein of unknown function (bvu_2443) from bacteroides vulgatus atcc 8482 at 1.64 a resolution
PDB Compounds: (B:) uncharacterized periplasmic proteinSCOPe Domain Sequences for d3elgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3elgb_ d.98.2.1 (B:) Putative periplasmic protein BVU2443 {Bacteroides vulgatus [TaxId: 821]}
gdvvtrdvnklpvaaremigkhfsqtkvayikiekdlfqttsydvkladgielefnskge
wleidcknksvpstfipqaiskymkanynghktvkiernrkgyeltlenglevdfdqfgg
flklsd
SCOPe Domain Coordinates for d3elgb_:
Click to download the PDB-style file with coordinates for d3elgb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3elgb_:
- d3elgb_ first appeared in SCOP 1.75, called d3elgb1
- d3elgb_ appears in SCOPe 2.05
- d3elgb_ appears in SCOPe 2.07
- d3elgb_ appears in the current release, SCOPe 2.08
View in 3D
