Lineage for d3e46a2 (3e46 A:1-156)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2939236Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species)
    ubc1 homologue; also contains the C-terminal UBA domain
  7. 2939239Species Human (Homo sapiens) [TaxId:9606] [143064] (10 PDB entries)
    Uniprot P61086 1-156
  8. 2939241Domain d3e46a2: 3e46 A:1-156 [157995]
    Other proteins in same PDB: d3e46a1, d3e46a3
    complexed with ca; mutant

Details for d3e46a2

PDB Entry: 3e46 (more details), 1.86 Å

PDB Description: crystal structure of ubiquitin-conjugating enzyme e2-25kda (huntington interacting protein 2) m172a mutant
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2-25 kDa

SCOPe Domain Sequences for d3e46a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e46a2 d.20.1.1 (A:1-156) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Human (Homo sapiens) [TaxId: 9606]}
maniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqlei
kipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaa
epddpqdavvanqykqnpemfkqtarlwahvyagap

SCOPe Domain Coordinates for d3e46a2:

Click to download the PDB-style file with coordinates for d3e46a2.
(The format of our PDB-style files is described here.)

Timeline for d3e46a2: