Lineage for d3e29b_ (3e29 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944360Species Bordetella bronchiseptica [TaxId:518] [188610] (1 PDB entry)
  8. 2944362Domain d3e29b_: 3e29 B: [174552]
    automated match to d2f0xa1

Details for d3e29b_

PDB Entry: 3e29 (more details), 2.4 Å

PDB Description: x-ray structure of the protein q7we92_borbr from thioesterase superfamily. northeast structural genomics consortium target bor214a.
PDB Compounds: (B:) uncharacterized protein Q7WE92_BORBR

SCOPe Domain Sequences for d3e29b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e29b_ d.38.1.0 (B:) automated matches {Bordetella bronchiseptica [TaxId: 518]}
msstalemasrfvnrspfnrwlgmsvleageqgivlgikwreelisspeirsthggilat
lvdaagdyavalktghpvptmdmhvdyhrvatpgdlraegqvihfgkrfataharvldmd
gnlvasgralylira

SCOPe Domain Coordinates for d3e29b_:

Click to download the PDB-style file with coordinates for d3e29b_.
(The format of our PDB-style files is described here.)

Timeline for d3e29b_: