Lineage for d3e11a1 (3e11 A:1-113)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheetSuperfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) 
Family d.92.1.17: TTHA0227-like [160555] (2 proteins)
Pfam PFPF06262; DUF1025; minimal zincin fold that retains 3-stranded mixed beta-sheet and contains HExxH motif in the C-terminal helix; no metal ion bound to this motif is observed in the first determined structures
Pfam PF06262; DUF1025; minimal zincin fold that retains 3-stranded mixed beta-sheet and contains HExxH motif in the C-terminal helix; no metal ion bound to this motif is observed in the first determined structuresProtein Uncharacterized protein Acel_2062 [160558] (1 species) Species Acidothermus cellulolyticus [TaxId:28049] [160559] (1 PDB entry)
Uniprot A0LWM4 1-113
Domain d3e11a1: 3e11 A:1-113 [157969]
Other proteins in same PDB: d3e11a2, d3e11b3
complexed with act, ca
Details for d3e11a1
PDB Entry: 3e11 (more details), 1.8 Å
PDB Description: crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution
PDB Compounds: (A:) predicted zincin-like metalloproteaseSCOPe Domain Sequences for d3e11a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e11a1 d.92.1.17 (A:1-113) Uncharacterized protein Acel_2062 {Acidothermus cellulolyticus [TaxId: 28049]}
mvyvdpdrfdelvaealdgipeefaramrnvavfvedepddpellglyvgiplterttay
ggvlpdriiiyrnticalcetesevidevrktvvheiahhfgidderlhelgy
SCOPe Domain Coordinates for d3e11a1:
Click to download the PDB-style file with coordinates for d3e11a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3e11a1:
- d3e11a1 first appeared in SCOP 1.75
- d3e11a1 appears in SCOPe 2.07
View in 3D
