SCOP 1.75: Domain d3e11a1: 3e11 A:1-113

Lineage for d3e11a1 (3e11 A:1-113)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families)

5. Family d.92.1.17: TTHA0227-like [160555] (2 proteins)
   PF06262; DUF1025; minimal zincin fold that retains 3-stranded mixed beta-sheet and contains HExxH motif in the C-terminal helix; no metal ion bound to this motif is observed in the first determined structures

6. Protein Uncharacterized protein Acel_2062 [160558] (1 species)

7. Species Acidothermus cellulolyticus [TaxId:28049] [160559] (1 PDB entry)
   Uniprot A0LWM4 1-113

8. Domain d3e11a1: 3e11 A:1-113 [157969]
   complexed with act, ca

Details for d3e11a1

PDB Entry: 3e11, 1.8 Å

PDB Description: crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution

PDB Compounds: (A:) predicted zincin-like metalloprotease

SCOP Domain Sequences for d3e11a1:

Sequence; same for both SEQRES and ATOM records:

>d3e11a1 d.92.1.17 (A:1-113) Uncharacterized protein Acel_2062 {Acidothermus cellulolyticus [TaxId: 28049]}
mvyvdpdrfdelvaealdgipeefaramrnvavfvedepddpellglyvgiplterttay
ggvlpdriiiyrnticalcetesevidevrktvvheiahhfgidderlhelgy

Timeline for d3e11a1:

• d3e11a1 is new in SCOP 1.75
  
• d3e11a1 appears in SCOPe 2.01
  
• d3e11a1 appears in the current release, SCOPe 2.08