| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) ![]() |
| Family d.92.1.17: TTHA0227-like [160555] (2 proteins) PF06262; DUF1025; minimal zincin fold that retains 3-stranded mixed beta-sheet and contains HExxH motif in the C-terminal helix; no metal ion bound to this motif is observed in the first determined structures |
| Protein Uncharacterized protein Acel_2062 [160558] (1 species) |
| Species Acidothermus cellulolyticus [TaxId:28049] [160559] (1 PDB entry) Uniprot A0LWM4 1-113 |
| Domain d3e11a1: 3e11 A:1-113 [157969] complexed with act, ca |
PDB Entry: 3e11 (more details), 1.8 Å
SCOP Domain Sequences for d3e11a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e11a1 d.92.1.17 (A:1-113) Uncharacterized protein Acel_2062 {Acidothermus cellulolyticus [TaxId: 28049]}
mvyvdpdrfdelvaealdgipeefaramrnvavfvedepddpellglyvgiplterttay
ggvlpdriiiyrnticalcetesevidevrktvvheiahhfgidderlhelgy
Timeline for d3e11a1: