Lineage for d3duea1 (3due A:20-145)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.98: BLIP-like [55647] (2 superfamilies)
alpha(2)-beta(4); 2 layers: alpha/beta
Superfamily d.98.2: BT0923-like [160574] (2 families) 
Duplication: tandem repeat of two similar structural subdomains, which associate like the BLIP repeats but differ from them by transposition of the helicesFamily d.98.2.1: BT0923-like [160575] (3 proteins)
after putative calcium-regulated periplasmic protein BT0923 (PDB ID 3DUE; new)
Protein Putative periplasmic protein BVU2987 [160578] (1 species) Species Bacteroides vulgatus [TaxId:821] [160579] (1 PDB entry)
Uniprot A6L4L1 20-145
Domain d3duea1: 3due A:20-145 [157865]
Other proteins in same PDB: d3duea2
complexed with cac
Details for d3duea1
PDB Entry: 3due (more details), 1.85 Å
PDB Description: crystal structure of a putative periplasmic protein from duf2874 family (bvu_2987) from bacteroides vulgatus atcc 8482 at 1.85 a resolution
PDB Compounds: (A:) Putative periplasmic proteinSCOPe Domain Sequences for d3duea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3duea1 d.98.2.1 (A:20-145) Putative periplasmic protein BVU2987 {Bacteroides vulgatus [TaxId: 821]}
adddkpiqvnqlpqtaqtfikthfpdnkvamakmetdwfdksydviftngdklefdkkgi
wtevnckysavpvavvpdaikkyvatnypdakmlkierdkhdyevklsngweikfdmqfn
vididn
SCOPe Domain Coordinates for d3duea1:
Click to download the PDB-style file with coordinates for d3duea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3duea1:
- d3duea1 first appeared in SCOP 1.75
- d3duea1 appears in SCOPe 2.07
View in 3D
