PDB entry 3due

View 3due on RCSB PDB site
Description: crystal structure of a putative periplasmic protein from duf2874 family (bvu_2987) from bacteroides vulgatus atcc 8482 at 1.85 a resolution
Class: unknown function
Keywords: putative periplasmic protein, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, unknown function
Deposited on 2008-07-17, released 2008-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative periplasmic protein
  Species: Bacteroides vulgatus ATCC 8482 [TaxId:435590]
  Gene: YP_001300247.1, BVU_2987
  Database cross-references and differences (RAF-indexed):
  • Uniprot A6L4L1 (1-126)
    • leader sequence (0)
  Domains in SCOPe 2.08: d3duea1, d3duea2
• Heterogens: CAC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3dueA (A:)
  gadddkpiqvnqlpqtaqtfikthfpdnkvamakmetdwfdksydviftngdklefdkkg
  iwtevnckysavpvavvpdaikkyvatnypdakmlkierdkhdyevklsngweikfdmqf
  nvididn