Lineage for d3dtqc_ (3dtq C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1132927Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1132928Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1132929Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1133066Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 1133067Species Human (Homo sapiens) [TaxId:9606] [50836] (17 PDB entries)
  8. 1133100Domain d3dtqc_: 3dtq C: [174222]
    automated match to d1ngla_

Details for d3dtqc_

PDB Entry: 3dtq (more details), 2.5 Å

PDB Description: engineered human lipocalin 2 with specificity for y-dtpa, apo-form
PDB Compounds: (C:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3dtqc_:

Sequence, based on SEQRES records: (download)

>d3dtqc_ b.60.1.1 (C:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
qdstsdlipapplskvplqqnfqdnqfhgkwyqvgragnaalredkdpqkmtaqiyelke
dksynvtavrfrkkkcdyatmtfvpgsqpgeftlgniksypgltsylvrvvstnynqham
vffkkvsqnreyfsitllgrtkelaselkenfirfskslglpenhivfpvpidqcid

Sequence, based on observed residues (ATOM records): (download)

>d3dtqc_ b.60.1.1 (C:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
qdstsdlipapplskvplqqnfqdnqfhgkwyqvgragnaalpqkmtaqiyelkedksyn
vtavrfrkkkcdyatmtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkk
vsqnreyfsitllgrtkelaselkenfirfskslglpenhivfpvpidqcid

SCOPe Domain Coordinates for d3dtqc_:

Click to download the PDB-style file with coordinates for d3dtqc_.
(The format of our PDB-style files is described here.)

Timeline for d3dtqc_: