SCOPe 2.03: Domain d3dosa2: 3dos A:148-235

Lineage for d3dosa2 (3dos A:148-235)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.7: C2 domain-like [49561] (5 superfamilies)
sandwich; 8 strands in 2 sheets; greek-key
Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families)
Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
Protein Caf1m [89221] (1 species)
chaperone of F1 capsule antigen Caf1
Species Yersinia pestis [TaxId:632] [89222] (8 PDB entries)
Domain d3dosa2: 3dos A:148-235 [199260]
Other proteins in same PDB: d3dosa1, d3dosb_, d3dosc_, d3dosd1, d3dose_, d3dosf_
automated match to d1p5va2
mutant

Details for d3dosa2

PDB Entry: 3dos (more details), 2.4 Å

PDB Description: crystal structure of the complex of the caf1m chaperone with the mini- fiber of two caf1 subunits (caf1:caf1), carrying the thr7phe and ala9val mutations in the gd donor strand

PDB Compounds: (A:) Chaperone protein Caf1M

SCOPe Domain Sequences for d3dosa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dosa2 b.7.2.1 (A:148-235) Caf1m {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg
lagarnvswriindqggldrlysknvtl

SCOPe Domain Coordinates for d3dosa2:

Click to download the PDB-style file with coordinates for d3dosa2.
(The format of our PDB-style files is described here.)

Timeline for d3dosa2: