SCOPe 2.03: Domain d3dosd2: 3dos D:148-233

Lineage for d3dosd2 (3dos D:148-233)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)

6. Protein Caf1m [89221] (1 species)
   chaperone of F1 capsule antigen Caf1

7. Species Yersinia pestis [TaxId:632] [89222] (8 PDB entries)

8. Domain d3dosd2: 3dos D:148-233 [199262]
   Other proteins in same PDB: d3dosa1, d3dosb_, d3dosc_, d3dosd1, d3dose_, d3dosf_
   automated match to d1p5va2
   mutant

Details for d3dosd2

PDB Entry: 3dos, 2.4 Å

PDB Description: crystal structure of the complex of the caf1m chaperone with the mini- fiber of two caf1 subunits (caf1:caf1), carrying the thr7phe and ala9val mutations in the gd donor strand

PDB Compounds: (D:) Chaperone protein Caf1M

SCOPe Domain Sequences for d3dosd2:

Sequence, based on SEQRES records:

>d3dosd2 b.7.2.1 (D:148-233) Caf1m {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg
lagarnvswriindqggldrlysknv

Sequence, based on observed residues (ATOM records):

>d3dosd2 b.7.2.1 (D:148-233) Caf1m {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpnv
swriindqggldrlysknv

Timeline for d3dosd2:

• d3dosd2 is new in SCOPe 2.03-stable
  
• d3dosd2 appears in SCOPe 2.04
  
• d3dosd2 appears in the current release, SCOPe 2.08