Lineage for d3diea_ (3die A:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.1: Thioltransferase [52834] (16 proteins) 
Protein Thioredoxin [52835] (15 species) 
Species Staphylococcus aureus [TaxId:1280] [187358] (5 PDB entries) 
Domain d3diea_: 3die A: [173978]
automated match to d1nswa_
complexed with cd, fe; mutant
Details for d3diea_
PDB Entry: 3die (more details), 1.85 Å
PDB Description: domain swapping of staphylococcus aureus thioredoxin w28a mutant
PDB Compounds: (A:) thioredoxinSCOPe Domain Sequences for d3diea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3diea_ c.47.1.1 (A:) Thioredoxin {Staphylococcus aureus [TaxId: 1280]}
shmaivkvtdadfdskvesgvqlvdfwatacgpckmiapvleelaadyegkadilkldvd
enpstaakyevmsiptlivfkdgqpvdkvvgfqpkenlaevldkhl
SCOPe Domain Coordinates for d3diea_:
Click to download the PDB-style file with coordinates for d3diea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3diea_:
- d3diea_ first appeared in SCOPe 2.01
- d3diea_ appears in SCOPe 2.03
- d3diea_ appears in SCOPe 2.05
- d3diea_ appears in the current release, SCOPe 2.08, called d3diea1
View in 3D
