Lineage for d3di6a3 (3di6 A:430-555)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (18 families) 
consists of one domain of this fold
Family c.55.3.0: automated matches [191357] (1 protein)
not a true familyProtein automated matches [190396] (40 species)
not a true protein
Species Human immunodeficiency virus type 1 [TaxId:11706] [225515] (19 PDB entries) 
Domain d3di6a3: 3di6 A:430-555 [199235]
Other proteins in same PDB: d3di6a2, d3di6b_
complexed with pdz
Details for d3di6a3
PDB Entry: 3di6 (more details), 2.65 Å
PDB Description: HIV-1 RT with pyridazinone non-nucleoside inhibitor
PDB Compounds: (A:) Reverse transcriptase/ribonuclease HSCOPe Domain Sequences for d3di6a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3di6a3 c.55.3.0 (A:430-555) automated matches {Human immunodeficiency virus type 1 [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsag
SCOPe Domain Coordinates for d3di6a3:
Click to download the PDB-style file with coordinates for d3di6a3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3di6a3:
- d3di6a3 first appeared in SCOPe 2.03
- d3di6a3 appears in SCOPe 2.07
View in 3D
