Lineage for d3di6a3 (3di6 A:430-555)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887435Species Human immunodeficiency virus type 1 [TaxId:11706] [225515] (19 PDB entries)
  8. 2887438Domain d3di6a3: 3di6 A:430-555 [199235]
    Other proteins in same PDB: d3di6a2, d3di6b_
    complexed with pdz

Details for d3di6a3

PDB Entry: 3di6 (more details), 2.65 Å

PDB Description: HIV-1 RT with pyridazinone non-nucleoside inhibitor
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3di6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3di6a3 c.55.3.0 (A:430-555) automated matches {Human immunodeficiency virus type 1 [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsag

SCOPe Domain Coordinates for d3di6a3:

Click to download the PDB-style file with coordinates for d3di6a3.
(The format of our PDB-style files is described here.)

Timeline for d3di6a3:

View in 3D
Domains from same chain:
(mouse over for more information)
d3di6a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3di6b_