Lineage for d3dgqb1 (3dgq B:2-76)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132062Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2132391Protein Class pi GST [81358] (4 species)
  7. 2132392Species Human (Homo sapiens) [TaxId:9606] [52864] (59 PDB entries)
  8. 2132400Domain d3dgqb1: 3dgq B:2-76 [209174]
    Other proteins in same PDB: d3dgqa2, d3dgqb2
    automated match to d13gsa2
    complexed with ca, cl, eaa, mes, so4

Details for d3dgqb1

PDB Entry: 3dgq (more details), 1.6 Å

PDB Description: Crystal structure of the glutathione transferase PI enzyme in complex with the bifunctional inhibitor, etharapta
PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d3dgqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dgqb1 c.47.1.5 (B:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

SCOPe Domain Coordinates for d3dgqb1:

Click to download the PDB-style file with coordinates for d3dgqb1.
(The format of our PDB-style files is described here.)

Timeline for d3dgqb1:

2132400
d3dgqb1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3dgqb2