Lineage for d3caqb_ (3caq B:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sitesSuperfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) 
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
Common fold covers whole protein structure
Protein automated matches [190169] (5 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188399] (48 PDB entries) 
Domain d3caqb_: 3caq B: [173105]
automated match to d1q13a_
complexed with bme, edo, mpd, ndp
Details for d3caqb_
PDB Entry: 3caq (more details), 2.2 Å
PDB Description: crystal structure of 5beta-reductase (akr1d1) in complex with nadph
PDB Compounds: (B:) 3-oxo-5-beta-steroid 4-dehydrogenaseSCOPe Domain Sequences for d3caqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3caqb_ c.1.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsaashriplsdgnsipiiglgtysepkstpkgacatsvkvaidtgyrhidgayiyqneh
evgeairekiaegkvrredifycgklwatnhvpemvrptlertlrvlqldyvdlyiievp
mafkpgdeiyprdengkwlyhksnlcatweameackdaglvkslgvsnfnrrqlelilnk
pglkhkpvsnqvechpyftqpkllkfcqqhdivitaysplgtsrnpiwvnvssppllkda
llnslgkrynktaaqivlrfniqrgvvvipksfnlerikenfqifdfslteeemkdieal
nknvrfvellmwrdhpeypfhdey
SCOPe Domain Coordinates for d3caqb_:
Click to download the PDB-style file with coordinates for d3caqb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3caqb_:
- d3caqb_ first appeared in SCOPe 2.01
- d3caqb_ appears in SCOPe 2.03
- d3caqb_ appears in SCOPe 2.05
- d3caqb_ appears in the current release, SCOPe 2.08
View in 3D
