![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.2: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56307] (2 proteins) |
![]() | Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56308] (3 species) |
![]() | Species Yeast (Candida albicans) [TaxId:5476] [160868] (1 PDB entry) Uniprot Q5A5Q7 16-337 |
![]() | Domain d3c9fa2: 3c9f A:16-337 [156126] Other proteins in same PDB: d3c9fa1, d3c9fa3, d3c9fb1 complexed with fmt, na, zn |
PDB Entry: 3c9f (more details), 1.9 Å
SCOPe Domain Sequences for d3c9fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Yeast (Candida albicans) [TaxId: 5476]} sfphrnltwndinfvhttdthgwysghinqplyhanwgdfisftthmrriahsrnqdlll idsgdrhdgnglsditspnglkstpifikqdydlltignhelylwenskqeyetvvnhfq dkyvcsnvdirldnglfvplglkykyfttpirgirvmafgflfdfkrfnsgtrvtpmaet ihepwfqealkhevdliiivghtpishnwgefyqvhqylrqffpdtiiqyfgghshirdf tvfdslstglqsgrycetvgwtsvnldkadlnlpvrqrfsrsyidfntdsfkyhtnldke fdtakgklvskliretrkelkl
Timeline for d3c9fa2: