Lineage for d3c9fa2 (3c9f A:16-337)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2603960Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2603961Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2604038Family d.159.1.2: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56307] (2 proteins)
  6. 2604039Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56308] (3 species)
  7. 2604058Species Yeast (Candida albicans) [TaxId:5476] [160868] (1 PDB entry)
    Uniprot Q5A5Q7 16-337
  8. 2604059Domain d3c9fa2: 3c9f A:16-337 [156126]
    Other proteins in same PDB: d3c9fa1, d3c9fa3, d3c9fb1
    complexed with fmt, na, zn

Details for d3c9fa2

PDB Entry: 3c9f (more details), 1.9 Å

PDB Description: crystal structure of 5'-nucleotidase from candida albicans sc5314
PDB Compounds: (A:) 5'-nucleotidase

SCOPe Domain Sequences for d3c9fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Yeast (Candida albicans) [TaxId: 5476]}
sfphrnltwndinfvhttdthgwysghinqplyhanwgdfisftthmrriahsrnqdlll
idsgdrhdgnglsditspnglkstpifikqdydlltignhelylwenskqeyetvvnhfq
dkyvcsnvdirldnglfvplglkykyfttpirgirvmafgflfdfkrfnsgtrvtpmaet
ihepwfqealkhevdliiivghtpishnwgefyqvhqylrqffpdtiiqyfgghshirdf
tvfdslstglqsgrycetvgwtsvnldkadlnlpvrqrfsrsyidfntdsfkyhtnldke
fdtakgklvskliretrkelkl

SCOPe Domain Coordinates for d3c9fa2:

Click to download the PDB-style file with coordinates for d3c9fa2.
(The format of our PDB-style files is described here.)

Timeline for d3c9fa2: