![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein automated matches [190329] (10 species) not a true protein |
![]() | Species Agkistrodon rhodostoma [TaxId:8717] [188575] (1 PDB entry) |
![]() | Domain d3bx4d_: 3bx4 D: [231870] automated match to d2vrpb_ complexed with gol, so4 |
PDB Entry: 3bx4 (more details), 1.7 Å
SCOPe Domain Sequences for d3bx4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bx4d_ d.169.1.1 (D:) automated matches {Agkistrodon rhodostoma [TaxId: 8717]} dcpsgwssyeghcykpfnepknwadaerfcklqpkhshlvsfqsaeeadfvvkltrprlk anlvwmglsniwhgcnwqwsdgarlnykdwqeqseclafrgvhtewlnmdcsstcsfvck fka
Timeline for d3bx4d_: