Lineage for d3bx4d_ (3bx4 D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1442551Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1442983Protein automated matches [190329] (6 species)
    not a true protein
  7. 1442984Species Agkistrodon rhodostoma [TaxId:8717] [188575] (1 PDB entry)
  8. 1442988Domain d3bx4d_: 3bx4 D: [231870]
    automated match to d2vrpb_
    complexed with gol, so4

Details for d3bx4d_

PDB Entry: 3bx4 (more details), 1.7 Å

PDB Description: Crystal structure of the snake venom toxin aggretin
PDB Compounds: (D:) Aggretin beta chain

SCOPe Domain Sequences for d3bx4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bx4d_ d.169.1.1 (D:) automated matches {Agkistrodon rhodostoma [TaxId: 8717]}
dcpsgwssyeghcykpfnepknwadaerfcklqpkhshlvsfqsaeeadfvvkltrprlk
anlvwmglsniwhgcnwqwsdgarlnykdwqeqseclafrgvhtewlnmdcsstcsfvck
fka

SCOPe Domain Coordinates for d3bx4d_:

Click to download the PDB-style file with coordinates for d3bx4d_.
(The format of our PDB-style files is described here.)

Timeline for d3bx4d_: