Lineage for d3bplb2 (3bpl B:97-199)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1767526Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1767985Protein automated matches [190888] (1 species)
    not a true protein
  7. 1767986Species Human (Homo sapiens) [TaxId:9606] [188282] (27 PDB entries)
  8. 1768027Domain d3bplb2: 3bpl B:97-199 [199114]
    Other proteins in same PDB: d3bpla_, d3bplc1, d3bplc2
    automated match to d1iarb2
    complexed with nag

Details for d3bplb2

PDB Entry: 3bpl (more details), 2.93 Å

PDB Description: crystal structure of the il4-il4r-common gamma ternary complex
PDB Compounds: (B:) Interleukin-4 receptor alpha chain

SCOPe Domain Sequences for d3bplb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bplb2 b.1.2.1 (B:97-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kprapgnltvhtqvsdtllltwsnpyppdnylynhltyavniwsendpadfriyqvtyle
pslriaastlksgisyrarvrawaqcynttwsewspstkwhns

SCOPe Domain Coordinates for d3bplb2:

Click to download the PDB-style file with coordinates for d3bplb2.
(The format of our PDB-style files is described here.)

Timeline for d3bplb2:

1768027
d3bplb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3bplb1