Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
Protein automated matches [226887] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries) |
Domain d3bjuc2: 3bju C:222-575 [208652] Other proteins in same PDB: d3bjua1, d3bjub1, d3bjuc1, d3bjud1 automated match to d1bbua2 complexed with atp, ca, lys |
PDB Entry: 3bju (more details), 2.31 Å
SCOPe Domain Sequences for d3bjuc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bjuc2 d.104.1.0 (C:222-575) automated matches {Human (Homo sapiens) [TaxId: 9606]} dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak pfityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefy mayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkp
Timeline for d3bjuc2: