Lineage for d3bida1 (3bid A:1-56)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882830Fold d.348: YegP-like [160112] (1 superfamily)
    comprises two subunits or tandem repeats of beta(3)-alpha-beta motifs; these assemble with the formation of a single beta-sheet and swapping of the C-terminal strands
  4. 882831Superfamily d.348.1: YegP-like [160113] (1 family) (S)
  5. 882832Family d.348.1.1: YegP-like [160114] (4 proteins)
    Pfam PF07411; DUF1508
  6. 882837Protein Uncharacterized protein NMB1088 [160121] (1 species)
    homodimer
  7. 882838Species Neisseria meningitidis [TaxId:487] [160122] (1 PDB entry)
    Uniprot Q7DDI1 1-56
  8. 882839Domain d3bida1: 3bid A:1-56 [155299]

Details for d3bida1

PDB Entry: 3bid (more details), 2.7 Å

PDB Description: crystal structure of the nmb1088 protein from neisseria meningitidis. northeast structural genomics consortium target mr91
PDB Compounds: (A:) UPF0339 protein NMB1088

SCOP Domain Sequences for d3bida1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bida1 d.348.1.1 (A:1-56) Uncharacterized protein NMB1088 {Neisseria meningitidis [TaxId: 487]}
myfeiykdakgeyrwrlkaanheiiaqgegytskqncqhavdllksttaatpvkev

SCOP Domain Coordinates for d3bida1:

Click to download the PDB-style file with coordinates for d3bida1.
(The format of our PDB-style files is described here.)

Timeline for d3bida1: