Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.348: YegP-like [160112] (1 superfamily) comprises two subunits or tandem repeats of beta(3)-alpha-beta motifs; these assemble with the formation of a single beta-sheet and swapping of the C-terminal strands |
Superfamily d.348.1: YegP-like [160113] (1 family) |
Family d.348.1.1: YegP-like [160114] (4 proteins) Pfam PF07411; DUF1508 |
Protein Uncharacterized protein NMB1088 [160121] (1 species) homodimer |
Species Neisseria meningitidis [TaxId:487] [160122] (1 PDB entry) Uniprot Q7DDI1 1-56 |
Domain d3bida1: 3bid A:1-56 [155299] |
PDB Entry: 3bid (more details), 2.7 Å
SCOP Domain Sequences for d3bida1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bida1 d.348.1.1 (A:1-56) Uncharacterized protein NMB1088 {Neisseria meningitidis [TaxId: 487]} myfeiykdakgeyrwrlkaanheiiaqgegytskqncqhavdllksttaatpvkev
Timeline for d3bida1: