Lineage for d3bdua1 (3bdu A:2-54)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123076Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1123077Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1123474Family b.38.1.6: YgdI/YgdR-like [159052] (7 proteins)
    Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals
  6. 1123483Protein Uncharacterized protein ECA1013 [159057] (1 species)
  7. 1123484Species Erwinia carotovora [TaxId:554] [159058] (1 PDB entry)
    Uniprot Q6D8G1 21-73
  8. 1123485Domain d3bdua1: 3bdu A:2-54 [155154]

Details for d3bdua1

PDB Entry: 3bdu (more details), 1.9 Å

PDB Description: crystal structure of protein q6d8g1 at the resolution 1.9 a. northeast structural genomics consortium target ewr22a.
PDB Compounds: (A:) Putative lipoprotein

SCOPe Domain Sequences for d3bdua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bdua1 b.38.1.6 (A:2-54) Uncharacterized protein ECA1013 {Erwinia carotovora [TaxId: 554]}
ssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgk

SCOPe Domain Coordinates for d3bdua1:

Click to download the PDB-style file with coordinates for d3bdua1.
(The format of our PDB-style files is described here.)

Timeline for d3bdua1: