Lineage for d3arcj_ (3arc J:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (1 family) (S)
    automatically mapped to Pfam PF01788
  5. Family f.23.32.1: PsbJ-like [161022] (2 proteins)
    Pfam PF01788
  6. Protein automated matches [191002] (2 species)
    not a true protein
  7. Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (3 PDB entries)
  8. 1698670Domain d3arcj_: 3arc J: [172315]
    Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arci_, d3arck_, d3arcl_, d3arcm_, d3arco_, d3arct_, d3arcu_, d3arcv_, d3arcz_
    automated match to d2axtj1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d3arcj_

PDB Entry: 3arc (more details), 1.9 Å

PDB Description: Crystal structure of oxygen-evolving Photosystem II at 1.9 angstrom resolution
PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d3arcj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arcj_ f.23.32.1 (J:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
seggriplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d3arcj_:

Click to download the PDB-style file with coordinates for d3arcj_.
(The format of our PDB-style files is described here.)

Timeline for d3arcj_: