Lineage for d3arce_ (3arc E:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. Protein Cytochrome b559 subunit alpha, PsbE [161047] (2 species)
  7. Species Thermosynechococcus vulcanus [TaxId:32053] [189913] (5 PDB entries)
  8. 1698750Domain d3arce_: 3arc E: [172312]
    Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arcf_, d3arch_, d3arci_, d3arcj_, d3arck_, d3arcl_, d3arcm_, d3arco_, d3arct_, d3arcu_, d3arcv_, d3arcz_
    automated match to d2axte1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d3arce_

PDB Entry: 3arc (more details), 1.9 Å

PDB Description: Crystal structure of oxygen-evolving Photosystem II at 1.9 angstrom resolution
PDB Compounds: (E:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d3arce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arce_ f.23.38.1 (E:) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus vulcanus [TaxId: 32053]}
ttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsi
plvtdrfeakqqvetfleqlk

SCOPe Domain Coordinates for d3arce_:

Click to download the PDB-style file with coordinates for d3arce_.
(The format of our PDB-style files is described here.)

Timeline for d3arce_: