Lineage for d3alya_ (3aly A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (18 families) 
consists of one domain of this fold
Family c.55.3.0: automated matches [191357] (1 protein)
not a true familyProtein automated matches [190396] (40 species)
not a true protein
Species Sulfolobus tokodaii [TaxId:273063] [255750] (2 PDB entries) 
Domain d3alya_: 3aly A: [245170]
automated match to d3u3ga_
Details for d3alya_
PDB Entry: 3aly (more details), 1.66 Å
PDB Description: Crystal Structure of RNase HI from Sulfolobus tokodaii with C-terminal deletion
PDB Compounds: (A:) Putative uncharacterized protein ST0753SCOPe Domain Sequences for d3alya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3alya_ c.55.3.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
miigyfdglcepknpggiatfgfviyldnrkiegyglaekpfsinstnnvaeysgliclm
etmlrlgisspiikgdsqlvikqmngeykvkakriiplyekaielkkklnatliwvpree
nkeadrlsrvayelvrrgklr
SCOPe Domain Coordinates for d3alya_:
Click to download the PDB-style file with coordinates for d3alya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3alya_:
- d3alya_ first appeared in SCOPe 2.04
- d3alya_ appears in SCOPe 2.07
View in 3D
