| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H3 [47122] (6 species) |
| Species Human (Homo sapiens) [TaxId:9606] [187038] (13 PDB entries) |
| Domain d3afae_: 3afa E: [172035] Other proteins in same PDB: d3afab_, d3afac_, d3afad_, d3afaf_, d3afag_, d3afah_ automated match to d1kx5a_ protein/DNA complex; complexed with cl, mn |
PDB Entry: 3afa (more details), 2.5 Å
SCOPe Domain Sequences for d3afae_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3afae_ a.22.1.1 (E:) Histone H3 {Human (Homo sapiens) [TaxId: 9606]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeac
eaylvglfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d3afae_: