SCOPe 2.07: Domain d3a13a2: 3a13 A:136-444

Lineage for d3a13a2 (3a13 A:136-444)

Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites

Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
automatically mapped to Pfam PF00016
Family c.1.14.0: automated matches [227297] (1 protein)
not a true family
Protein automated matches [227123] (9 species)
not a true protein
Species Pyrococcus kodakaraensis [TaxId:69014] [226763] (2 PDB entries)

Domain d3a13a2: 3a13 A:136-444 [208062]
Other proteins in same PDB: d3a13a1, d3a13b1, d3a13c1, d3a13d1, d3a13e1, d3a13f1, d3a13g1, d3a13h1, d3a13i1, d3a13j1
automated match to d1bxna1
complexed with ca, cap, mg; mutant

Details for d3a13a2

PDB Entry: 3a13 (more details), 2.34 Å

PDB Description: crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp and activated with ca

PDB Compounds: (A:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3a13a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a13a2 c.1.14.0 (A:136-444) automated matches {Pyrococcus kodakaraensis [TaxId: 69014]}
fdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkddenlt
spwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkhamvd
vvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligidqlhv
gtagagklegerditiqnarilreshykpdendvfhleqkfysikaafptssgglhpgni
qpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelaral
ekwghvtpv

SCOPe Domain Coordinates for d3a13a2:

Click to download the PDB-style file with coordinates for d3a13a2.
(The format of our PDB-style files is described here.)

Timeline for d3a13a2: