Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) Pfam PF06596 |
Family f.23.40.1: PsbX-like [267615] (2 proteins) |
Protein Photosystem II reaction center protein X, PsbX [267653] (1 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [267728] (1 PDB entry) |
Domain d3a0hx_: 3a0h X: [264657] Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hy_, d3a0hz_ complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9 |
PDB Entry: 3a0h (more details), 4 Å
SCOPe Domain Sequences for d3a0hx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a0hx_ f.23.40.1 (X:) Photosystem II reaction center protein X, PsbX {Thermosynechococcus vulcanus [TaxId: 32053]} titpslkgffigllsgavvlgltfavliaisqid
Timeline for d3a0hx_: