Lineage for d3a0fa2 (3a0f A:423-755)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
consists of seven 4-stranded beta-sheet motifs; meanderSuperfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families) 
duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378)Family b.69.13.0: automated matches [227242] (1 protein)
not a true familyProtein automated matches [227008] (11 species)
not a true protein
Species Geotrichum sp. [TaxId:203496] [225698] (1 PDB entry) 
Domain d3a0fa2: 3a0f A:423-755 [208038]
automated match to d1sqja2
Details for d3a0fa2
PDB Entry: 3a0f (more details), 2.5 Å
PDB Description: The crystal structure of Geotrichum sp. M128 xyloglucanase
PDB Compounds: (A:) xyloglucanaseSCOPe Domain Sequences for d3a0fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a0fa2 b.69.13.0 (A:423-755) automated matches {Geotrichum sp. [TaxId: 203496]}
qapswyintegieetailvlksppagpahlfsgmydlggmrhddfsvpqpmyskptfsst
dgldfagraanvlarvgrndhpdagvagctqgayttnsgdswtlfqtcvpslevgnggti
avgadgktfvwspskadgkgpytssdygktwtapsglskqttgiaadrvqantfyvyveg
dffvstdggksytkkgnglpccwtytgtpvtsnlragelwvsvkgvgiyhstdfgntfta
lagsgsslnpavfsigapqtpnatetlflwgipsasqpeglymstdngglwtrlnddahn
yggatvisgdpriygrvyigmngrgiicaqalg
SCOPe Domain Coordinates for d3a0fa2:
Click to download the PDB-style file with coordinates for d3a0fa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3a0fa2:
- d3a0fa2 first appeared in SCOPe 2.03
- d3a0fa2 appears in SCOPe 2.07
View in 3D
