Lineage for d2zqna1 (2zqn A:131-260)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) 
Family b.42.2.1: Ricin B-like [50371] (10 proteins) 
Protein 29-kDa galactose-binding lectin [159148] (1 species)
duplication: tadem repeat of two Ricin B-like domainsSpecies Lumbricus terrestris [TaxId:6398] [159149] (2 PDB entries)
Uniprot O96048 131-260
Domain d2zqna1: 2zqn A:131-260 [154763]
automatically matched to 2ZQO A:131-260
complexed with bgc, gal, imd, po4
Details for d2zqna1
PDB Entry: 2zqn (more details), 1.9 Å
PDB Description: crystal structure of the earthworm r-type lectin c-half in complex with lactose
PDB Compounds: (A:) 29-kDa galactose-binding lectinSCOP Domain Sequences for d2zqna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]}
pkffyikselngkvldiegqnpapgskiitwdqkkgptavnqlwytdqqgvirsklndfa
idasheqietqpfdpnnpkrawivsgntiaqlsdrdivldiiksdkeagahicawkqhgg
pnqkfiiese
SCOP Domain Coordinates for d2zqna1:
Click to download the PDB-style file with coordinates for d2zqna1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2zqna1:
- d2zqna1 is new in SCOP 1.75
- d2zqna1 is called d2zqna_ in SCOPe 2.01
- d2zqna1 appears in the current release, SCOPe 2.08, called d2zqna_
View in 3D
