Class b: All beta proteins [48724] (174 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) |
Family b.42.2.1: Ricin B-like [50371] (10 proteins) |
Protein 29-kDa galactose-binding lectin [159148] (1 species) duplication: tadem repeat of two Ricin B-like domains |
Species Lumbricus terrestris [TaxId:6398] [159149] (2 PDB entries) Uniprot O96048 131-260 |
Domain d2zqna1: 2zqn A:131-260 [154763] automatically matched to 2ZQO A:131-260 complexed with bgc, gal, imd, po4 |
PDB Entry: 2zqn (more details), 1.9 Å
SCOP Domain Sequences for d2zqna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} pkffyikselngkvldiegqnpapgskiitwdqkkgptavnqlwytdqqgvirsklndfa idasheqietqpfdpnnpkrawivsgntiaqlsdrdivldiiksdkeagahicawkqhgg pnqkfiiese
Timeline for d2zqna1: