| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families) ![]() |
| Family b.1.14.0: automated matches [231720] (1 protein) not a true family |
| Protein automated matches [231721] (3 species) not a true protein |
| Species Escherichia coli [TaxId:83334] [231722] (1 PDB entry) |
| Domain d2zqka1: 2zqk A:6-94 [231723] Other proteins in same PDB: d2zqka2, d2zqkb2 automated match to d1f00i2 |
PDB Entry: 2zqk (more details), 2.8 Å
SCOPe Domain Sequences for d2zqka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zqka1 b.1.14.0 (A:6-94) automated matches {Escherichia coli [TaxId: 83334]}
ffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasgk
vtlngkgsvvikatsgdkqtvsytikaps
Timeline for d2zqka1: