Lineage for d2yhob_ (2yho B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2Superfamily d.20.1: UBC-like [54495] (5 families) 
Family d.20.1.1: UBC-related [54496] (7 proteins) 
Protein automated matches [190124] (12 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [186848] (39 PDB entries) 
Domain d2yhob_: 2yho B: [170787]
automated match to d1z2ua1
complexed with act, zn
Details for d2yhob_
PDB Entry: 2yho (more details), 2.1 Å
PDB Description: the idol-ube2d complex mediates sterol-dependent degradation of the ldl receptor
PDB Compounds: (B:) ubiquitin-conjugating enzyme e2 d1SCOPe Domain Sequences for d2yhob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yhob_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamalkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfpt
dypfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddp
lvpdiaqiyksdkekynrharewtqkyam
SCOPe Domain Coordinates for d2yhob_:
Click to download the PDB-style file with coordinates for d2yhob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2yhob_:
- d2yhob_ first appeared in SCOPe 2.01
- d2yhob_ appears in SCOPe 2.04
- d2yhob_ is called d2yhob1 in SCOPe 2.06
- d2yhob_ appears in the current release, SCOPe 2.08, called d2yhob1
View in 3D
