Lineage for d2y91b_ (2y91 B:)
- Root: SCOPe 2.04
Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
contains a cluster of helices and an alpha+beta sandwichSuperfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) Protein automated matches [190161] (19 species)
not a true protein
Species Bacillus licheniformis [TaxId:1402] [188244] (9 PDB entries) 
Domain d2y91b_: 2y91 B: [195980]
automated match to d2wk0a_
complexed with 98j, cit, pge
Details for d2y91b_
PDB Entry: 2y91 (more details), 2 Å
PDB Description: Crystal structure of class A beta-lactamase from Bacillus licheniformis BS3 with clavulanic acid
PDB Compounds: (B:) Beta-lactamaseSCOPe Domain Sequences for d2y91b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y91b_ e.3.1.1 (B:) automated matches {Bacillus licheniformis [TaxId: 1402]}
kddfakleeqfdaklgifaldtgtnrtvtyrpderfafaxtikaltvgvllqqksiedln
qritytrddlvnynpitekhvdtgmtlkeladaslrysdntaqnlilkqiggpeslkkel
rkigdevtnperfepelnevnpgetqdtstaralatslqafaledklpsekrellidwmk
rnttgdaliragvpegwevadktgagsygtrndiaiiwppkgdpvvlavlssrdkkdaky
ddkliaeatkvvvkaln
SCOPe Domain Coordinates for d2y91b_:
Click to download the PDB-style file with coordinates for d2y91b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2y91b_:
- d2y91b_ first appeared in SCOPe 2.02
- d2y91b_ appears in SCOPe 2.03
- d2y91b_ appears in SCOPe 2.05
- d2y91b_ appears in the current release, SCOPe 2.08
View in 3D
