Lineage for d2y85a_ (2y85 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2826664Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 2826714Protein automated matches [190186] (9 species)
    not a true protein
  7. 2826722Species Mycobacterium tuberculosis [TaxId:83332] [189657] (4 PDB entries)
  8. 2826725Domain d2y85a_: 2y85 A: [170683]
    automated match to d1vzwa1
    complexed with 137, cl, na

Details for d2y85a_

PDB Entry: 2y85 (more details), 2.4 Å

PDB Description: crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase with bound rcdrp
PDB Compounds: (A:) phosphoribosyl isomerase a

SCOPe Domain Sequences for d2y85a_:

Sequence, based on SEQRES records: (download)

>d2y85a_ c.1.2.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mplillpavdvvegravrlvqgkagsqteygsavdaalgwqrdgaewihlvdldaafgrg
snhellaevvgkldvqvelsggirddeslaaalatgcarvnvgtaalenpqwcarvigeh
gdqvavgldvqiidgehrlrgrgwetdggdlwdvlerldsegcsrfvvtditkdgtlggp
nldllagvadrtdapviasggvsslddlraiatlthrgvegaivgkalyarrftlpqala
avr

Sequence, based on observed residues (ATOM records): (download)

>d2y85a_ c.1.2.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mplillpavdvvegravrteygsavdaalgwqrdgaewihlvdldaafgrgsnhellaev
vgkldvqvelsggirddeslaaalatgcarvnvgtaalenpqwcarvigehgdqvavgld
vqiidgehrlrgrgwetdggdlwdvlerldsegcsrfvvtditkdgtlggpnldllagva
drtdapviasggvsslddlraiatlthrgvegaivgkalyarrftlpqalaavr

SCOPe Domain Coordinates for d2y85a_:

Click to download the PDB-style file with coordinates for d2y85a_.
(The format of our PDB-style files is described here.)

Timeline for d2y85a_: