Lineage for d2y7wc_ (2y7w C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390576Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1390577Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1390578Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1391375Protein automated matches [190140] (13 species)
    not a true protein
  7. 1391381Species Burkholderia sp. [TaxId:233098] [190010] (5 PDB entries)
  8. 1391397Domain d2y7wc_: 2y7w C: [207499]
    automated match to d2y84h_
    complexed with pg4, sal

Details for d2y7wc_

PDB Entry: 2y7w (more details), 2.89 Å

PDB Description: dntr inducer binding domain
PDB Compounds: (C:) LysR-type regulatory protein

SCOPe Domain Sequences for d2y7wc_:

Sequence, based on SEQRES records: (download)

>d2y7wc_ c.94.1.1 (C:) automated matches {Burkholderia sp. [TaxId: 233098]}
sfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavd
lalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghge
vdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpakl
pdiainlfwhakynrdpgnmwlrqlfvelfs

Sequence, based on observed residues (ATOM records): (download)

>d2y7wc_ c.94.1.1 (C:) automated matches {Burkholderia sp. [TaxId: 233098]}
sfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavd
lalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvahgevdgl
leragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklpdia
inlfwhakynrdpgnmwlrqlfvelfs

SCOPe Domain Coordinates for d2y7wc_:

Click to download the PDB-style file with coordinates for d2y7wc_.
(The format of our PDB-style files is described here.)

Timeline for d2y7wc_: