Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
Protein automated matches [190140] (13 species) not a true protein |
Species Burkholderia sp. [TaxId:233098] [190010] (5 PDB entries) |
Domain d2y7wc_: 2y7w C: [207499] automated match to d2y84h_ complexed with pg4, sal |
PDB Entry: 2y7w (more details), 2.89 Å
SCOPe Domain Sequences for d2y7wc_:
Sequence, based on SEQRES records: (download)
>d2y7wc_ c.94.1.1 (C:) automated matches {Burkholderia sp. [TaxId: 233098]} sfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavd lalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghge vdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpakl pdiainlfwhakynrdpgnmwlrqlfvelfs
>d2y7wc_ c.94.1.1 (C:) automated matches {Burkholderia sp. [TaxId: 233098]} sfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavd lalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvahgevdgl leragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklpdia inlfwhakynrdpgnmwlrqlfvelfs
Timeline for d2y7wc_: