Lineage for d2xkia_ (2xki A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1077267Family a.1.1.4: Nerve tissue mini-hemoglobin (neural globin) [74660] (2 proteins)
    lack the first helix but otherwise is more similar to conventional globins than the truncated ones
  6. 1077268Protein Nerve tissue mini-hemoglobin (neural globin) [74661] (1 species)
  7. 1077269Species Milky ribbon worm (Cerebratulus lacteus) [TaxId:6221] [74662] (11 PDB entries)
    Uniprot O76242
  8. 1077270Domain d2xkia_: 2xki A: [170181]
    automated match to d1kr7a_
    complexed with gol, hem, so4

Details for d2xkia_

PDB Entry: 2xki (more details), 1.3 Å

PDB Description: aquo-met structure of c.lacteus mini-hb
PDB Compounds: (A:) neural hemoglobin

SCOPe Domain Sequences for d2xkia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xkia_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]}
mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
adaaglasrhkgrnvgsaefhnakaclakacsahgapdlghaiddilshl

SCOPe Domain Coordinates for d2xkia_:

Click to download the PDB-style file with coordinates for d2xkia_.
(The format of our PDB-style files is described here.)

Timeline for d2xkia_: