Lineage for d2x77b_ (2x77 B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologies
Family c.37.1.0: automated matches [191323] (1 protein)
not a true familyProtein automated matches [190123] (158 species)
not a true protein
Species Leishmania major [TaxId:5664] [225849] (4 PDB entries) 
Domain d2x77b_: 2x77 B: [207138]
automated match to d1e0sa_
complexed with gdp, mg
Details for d2x77b_
PDB Entry: 2x77 (more details), 2.1 Å
PDB Description: crystal structure of leishmania major adp ribosylation factor-like 1.
PDB Compounds: (B:) ADP-ribosylation factorSCOPe Domain Sequences for d2x77b_:
Sequence, based on SEQRES records: (download)
>d2x77b_ c.37.1.0 (B:) automated matches {Leishmania major [TaxId: 5664]}
awlaslkqtlgllpadrkirvlmlgldnagktsilyrlhlgdvvttvptvgvnletlqyk
nisfevwdlggqtgvrpywrcyfsdtdaviyvvdstdrdrmgvakhelyalldedelrks
lllifankqdlpdaaseaeiaeqlgvssimnrtwtivksssktgdglvegmdwlverlre
q
Sequence, based on observed residues (ATOM records): (download)
>d2x77b_ c.37.1.0 (B:) automated matches {Leishmania major [TaxId: 5664]}
awlaslkqtlgllpadrkirvlmlgldnagktsilyrlhlgdvvttnletlqyknisfev
wdlggcyfsdtdaviyvvdstdrdrmgvakhelyalldedelrkslllifankqdlpdaa
seaeiaeqlgvssimnrtwtivksssktgdglvegmdwlverlreq
SCOPe Domain Coordinates for d2x77b_:
Click to download the PDB-style file with coordinates for d2x77b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2x77b_:
- d2x77b_ first appeared in SCOPe 2.03
- d2x77b_ appears in SCOPe 2.07
View in 3D
