Lineage for d2x30a_ (2x30 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1566369Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1566370Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 1566403Protein automated matches [190186] (7 species)
    not a true protein
  7. 1566417Species Streptomyces coelicolor [TaxId:1902] [189237] (2 PDB entries)
  8. 1566419Domain d2x30a_: 2x30 A: [169836]
    automated match to d1vzwa1
    complexed with so4; mutant

Details for d2x30a_

PDB Entry: 2x30 (more details), 1.95 Å

PDB Description: crystal structure of the r139n mutant of a bifunctional enzyme pria
PDB Compounds: (A:) phosphoribosyl isomerase a

SCOPe Domain Sequences for d2x30a_:

Sequence, based on SEQRES records: (download)

>d2x30a_ c.1.2.1 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
msklellpavdvrdgqavrlvhgesgtetsygspleaalawqrsgaewlhlvdldaafgt
gdnraliaevaqamdikvelsggirdddtlaaalatgctrvnlgtaaletpewvakviae
hgdkiavgldvrgttlrgngwtrdggdlyetldrlnkegcaryvvtdiakdgtlqgpnle
llknvcaatdrpvvasggvsslddlraiaglvpagvegaivgkalyakaftleealeats

Sequence, based on observed residues (ATOM records): (download)

>d2x30a_ c.1.2.1 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
msklellpavdvrdgqavrlvhgesgtetsygspleaalawqrsgaewlhlvdldaafgt
gdnraliaevaqamdikvelsggirdddtlaaalatgctrvnlgtaaletpewvakviae
hgdkiavgldvrgttlrgngwtrdggdlyetldrlnkegcaryvvtdiapnlellknvca
atdrpvvasggvsslddlraiaglvpagvegaivgkalyakaftleealeats

SCOPe Domain Coordinates for d2x30a_:

Click to download the PDB-style file with coordinates for d2x30a_.
(The format of our PDB-style files is described here.)

Timeline for d2x30a_: