SCOPe 2.07: Domain d2wnra2: 2wnr A:188-269

Lineage for d2wnra2 (2wnr A:188-269)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families)
Family d.101.1.0: automated matches [227218] (1 protein)
not a true family
Protein automated matches [226956] (5 species)
not a true protein
Species Methanothermobacter thermautotrophicus [TaxId:145262] [225886] (1 PDB entry)
Domain d2wnra2: 2wnr A:188-269 [231464]
Other proteins in same PDB: d2wnra1, d2wnrb1, d2wnrc1, d2wnrd1, d2wnre1, d2wnrf1
automated match to d2je6a2
complexed with po4

Details for d2wnra2

PDB Entry: 2wnr (more details), 2.65 Å

PDB Description: The structure of Methanothermobacter thermautotrophicus exosome core assembly

PDB Compounds: (A:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2wnra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wnra2 d.101.1.0 (A:188-269) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
pvnrkalmctfakigneivldpsleeediltarisigvteegsicamqkggegpltrddv
lkavsiavekvpqlieyldksm

SCOPe Domain Coordinates for d2wnra2:

Click to download the PDB-style file with coordinates for d2wnra2.
(The format of our PDB-style files is described here.)

Timeline for d2wnra2: