Lineage for d2wl3b2 (2wl3 B:135-287)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549945Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2549946Protein automated matches [190239] (26 species)
    not a true protein
  7. 2550092Species Rhodococcus sp. [TaxId:186196] [225962] (2 PDB entries)
  8. 2550104Domain d2wl3b2: 2wl3 B:135-287 [206878]
    automated match to d1hana2
    complexed with ca, fe, gol

Details for d2wl3b2

PDB Entry: 2wl3 (more details), 2.2 Å

PDB Description: crystal structure of catechol 2,3-dioxygenase
PDB Compounds: (B:) catechol 2,3-dioxygenase

SCOPe Domain Sequences for d2wl3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wl3b2 d.32.1.0 (B:135-287) automated matches {Rhodococcus sp. [TaxId: 186196]}
pmfgkfvtegqglghiiireddveeatrfyrllglegaveykfalpngavgtpvfmhcnd
rhhslafgvgpmdkrinhlmieythlddlgyahdlvrqqkidvtlqigkhsndealtfyc
anpsgwlwepgwgsrpapaqqehylrdifghdn

SCOPe Domain Coordinates for d2wl3b2:

Click to download the PDB-style file with coordinates for d2wl3b2.
(The format of our PDB-style files is described here.)

Timeline for d2wl3b2: