Lineage for d2wb2a2 (2wb2 A:216-509)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006420Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 2006421Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) (S)
    automatically mapped to Pfam PF03441
  5. 2006466Family a.99.1.0: automated matches [231382] (1 protein)
    not a true family
  6. 2006467Protein automated matches [231383] (1 species)
    not a true protein
  7. 2006468Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231384] (6 PDB entries)
  8. 2006474Domain d2wb2a2: 2wb2 A:216-509 [231385]
    Other proteins in same PDB: d2wb2a1
    automated match to d4mlpa2
    protein/DNA complex; complexed with fad

Details for d2wb2a2

PDB Entry: 2wb2 (more details), 2.95 Å

PDB Description: drosophila melanogaster (6-4) photolyase bound to double stranded dna containing a t(6-4)c photolesion
PDB Compounds: (A:) photolyase

SCOPe Domain Sequences for d2wb2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wb2a2 a.99.1.0 (A:216-509) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gpnkfpggetealrrmeeslkdeiwvarfekpntapnslepsttvlspylkfgclsarlf
nqklkeiikrqpkhsqppvsligqlmwrefyytvaaaepnfdrmlgnvycmqipwqehpd
hleawthgrtgypfidaimrqlrqegwihhlarhavacfltrgdlwisweegqrvfeqll
ldqdwalnagnwmwlsasaffhqyfrvyspvafgkktdpqghyirkyvpelskypagciy
epwkaslvdqraygcvlgtdyphrivkhevvhkenikrmgaaykvnrevrtgke

SCOPe Domain Coordinates for d2wb2a2:

Click to download the PDB-style file with coordinates for d2wb2a2.
(The format of our PDB-style files is described here.)

Timeline for d2wb2a2: