Lineage for d2w70a3 (2w70 A:331-446)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2082731Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2082834Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2082835Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 2082842Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 2082845Species Escherichia coli [TaxId:562] [51249] (24 PDB entries)
  8. 2082846Domain d2w70a3: 2w70 A:331-446 [206680]
    Other proteins in same PDB: d2w70a1, d2w70a2, d2w70b1, d2w70b2
    automated match to d1dv1a1
    complexed with cl, l22

Details for d2w70a3

PDB Entry: 2w70 (more details), 1.77 Å

PDB Description: crystal structure of biotin carboxylase from e. coli in complex with the amino-thiazole-pyrimidine fragment
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d2w70a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w70a3 b.84.2.1 (A:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl

SCOPe Domain Coordinates for d2w70a3:

Click to download the PDB-style file with coordinates for d2w70a3.
(The format of our PDB-style files is described here.)

Timeline for d2w70a3: