Lineage for d2w15a_ (2w15 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964135Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
    Pfam PF01421
  6. 2964140Protein Snake venom metalloprotease [55520] (7 species)
  7. 2964158Species Terciopelo (Bothrops asper), bap1 [TaxId:8722] [103127] (5 PDB entries)
  8. 2964159Domain d2w15a_: 2w15 A: [168999]
    automated match to d1nd1a_
    complexed with gol, wr2, zn

Details for d2w15a_

PDB Entry: 2w15 (more details), 1.05 Å

PDB Description: high-resolution crystal structure of the p-i snake venom metalloproteinase bap1 in complex with a peptidomimetic: insights into inhibitor binding
PDB Compounds: (A:) zinc metalloproteinase bap1

SCOPe Domain Sequences for d2w15a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w15a_ d.92.1.9 (A:) Snake venom metalloprotease {Terciopelo (Bothrops asper), bap1 [TaxId: 8722]}
erfspryielavvadhgiftkynsnlntirtrvhemlntvngfyrsvdvhaplanlevws
kqdlikvqkdssktlksfgewrerdllprishdhaqlltavvfdgntigraytggmcdpr
hsvgvvrdhsknnlwvavtmahelghnlgihhdtgscscgakscimasvlskvlsyefsd
csqnqyetyltnhnpqcilnkp

SCOPe Domain Coordinates for d2w15a_:

Click to download the PDB-style file with coordinates for d2w15a_.
(The format of our PDB-style files is described here.)

Timeline for d2w15a_: