Lineage for d1nd1a_ (1nd1 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964135Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
    Pfam PF01421
  6. 2964140Protein Snake venom metalloprotease [55520] (7 species)
  7. 2964158Species Terciopelo (Bothrops asper), bap1 [TaxId:8722] [103127] (5 PDB entries)
  8. 2964163Domain d1nd1a_: 1nd1 A: [91808]
    complexed with zn

Details for d1nd1a_

PDB Entry: 1nd1 (more details), 1.93 Å

PDB Description: amino acid sequence and crystal structure of bap1, a metalloproteinase from bothrops asper snake venom that exerts multiple tissue-damaging activities.
PDB Compounds: (A:) BaP1

SCOPe Domain Sequences for d1nd1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nd1a_ d.92.1.9 (A:) Snake venom metalloprotease {Terciopelo (Bothrops asper), bap1 [TaxId: 8722]}
erfspryielavvadhgiftkynsnlntirtrvhemlntvngfyrsvdvhaplanlevws
kqdlikvqkdssktlksfgewrerdllprishdhaqlltavvfdgntigraytggmcdpr
hsvgvvrdhsknnlwvavtmahelghnlgidhdtgscscgakscimasvlskvlsyefsd
csqnqyetyltnhnpqcilnkp

SCOPe Domain Coordinates for d1nd1a_:

Click to download the PDB-style file with coordinates for d1nd1a_.
(The format of our PDB-style files is described here.)

Timeline for d1nd1a_: