Lineage for d2vrfa_ (2vrf A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538457Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1538458Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1538459Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1538753Protein automated matches [190055] (7 species)
    not a true protein
  7. 1538765Species Human (Homo sapiens) [TaxId:9606] [187785] (36 PDB entries)
  8. 1538789Domain d2vrfa_: 2vrf A: [168768]
    automated match to d1qava_
    complexed with edo

Details for d2vrfa_

PDB Entry: 2vrf (more details), 2 Å

PDB Description: crystal structure of the human beta-2-syntrophin pdz domain
PDB Compounds: (A:) beta-2-syntrophin

SCOPe Domain Sequences for d2vrfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vrfa_ b.36.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smpvrrvrvvkqeagglgisikggrenrmpiliskifpglaadqsralrlgdailsvngt
dlrqathdqavqalkragkevllevkfirevntvv

SCOPe Domain Coordinates for d2vrfa_:

Click to download the PDB-style file with coordinates for d2vrfa_.
(The format of our PDB-style files is described here.)

Timeline for d2vrfa_: