Lineage for d2voia_ (2voi A:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1454901Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1454943Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1455135Family f.1.4.0: automated matches [195065] (1 protein)
    not a true family
  6. 1455136Protein automated matches [195066] (2 species)
    not a true protein
  7. 1455146Species Mouse (Mus musculus) [TaxId:10090] [195067] (4 PDB entries)
  8. 1455151Domain d2voia_: 2voi A: [195068]
    automated match to d2yj1a_
    complexed with cl

Details for d2voia_

PDB Entry: 2voi (more details), 2.1 Å

PDB Description: structure of mouse a1 bound to the bid bh3-domain
PDB Compounds: (A:) bcl-2-related protein a1

SCOPe Domain Sequences for d2voia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2voia_ f.1.4.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
smaeselmhihslaehylqyvlqvpafesapsqacrvlqrvafsvqkeveknlksylddf
hvesidtariifnqvmekefedgiinwgrivtifafggvllkklkqeqialdvsaykqvs
sfvaefimnntgewirqnggwedgfikkfe

SCOPe Domain Coordinates for d2voia_:

Click to download the PDB-style file with coordinates for d2voia_.
(The format of our PDB-style files is described here.)

Timeline for d2voia_: