SCOPe 2.08: Domain d2voia1: 2voi A:1-149

Lineage for d2voia1 (2voi A:1-149)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.0: automated matches [195065] (1 protein)
   not a true family

6. Protein automated matches [195066] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [195067] (5 PDB entries)

8. Domain d2voia1: 2voi A:1-149 [195068]
   Other proteins in same PDB: d2voia2
   automated match to d2yj1a_
   complexed with cl

Details for d2voia1

PDB Entry: 2voi, 2.1 Å

PDB Description: structure of mouse a1 bound to the bid bh3-domain

PDB Compounds: (A:) bcl-2-related protein a1

SCOPe Domain Sequences for d2voia1:

Sequence; same for both SEQRES and ATOM records:

>d2voia1 f.1.4.0 (A:1-149) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
maeselmhihslaehylqyvlqvpafesapsqacrvlqrvafsvqkeveknlksylddfh
vesidtariifnqvmekefedgiinwgrivtifafggvllkklkqeqialdvsaykqvss
fvaefimnntgewirqnggwedgfikkfe

Timeline for d2voia1:

• d2voia1 first appeared in SCOPe 2.02, called d2voia_
  
• d2voia1 appears in SCOPe 2.07