Lineage for d2vida_ (2vid A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.0: automated matches [191364] (1 protein)
not a true familyProtein automated matches [190438] (20 species)
not a true protein
Species Staphylococcus aureus [TaxId:1280] [187423] (4 PDB entries) 
Domain d2vida_: 2vid A: [198445]
automated match to d2vidb_
Details for d2vida_
PDB Entry: 2vid (more details), 1.8 Å
PDB Description: serine protease splb from staphylococcus aureus at 1.8a resolution
PDB Compounds: (A:) serine protease splbSCOPe Domain Sequences for d2vida_:
Sequence, based on SEQRES records: (download)
>d2vida_ b.47.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ennvtkvkdtnifpytgvvafksatgfvvgkntiltnkhvsknykvgdritahpnsdkgn
ggiysikkiinypgkedvsviqveeraiergpkgfnfndnvtpfkyaagakagerikvig
yphpyknkyvlyestgpvmsvegssivysahtesgnsgspvlnsnnelvgihfasdvknd
dnrnaygvyftpeikkfiaenidk
Sequence, based on observed residues (ATOM records): (download)
>d2vida_ b.47.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ennvtkvkdtnifpytgvvafksatgfvvgkntiltnkhvsknykvgdritahpnsdkgn
ggiysikkiinypgkedvsviqveeraiergpkgfnfndnvtpfkyaagakagerikvig
yphpykyvlyestgpvmsvegssivysahtesgnsgspvlnsnnelvgihfasdvdnrna
ygvyftpeikkfiaenidk
SCOPe Domain Coordinates for d2vida_:
Click to download the PDB-style file with coordinates for d2vida_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2vida_:
- d2vida_ first appeared in SCOPe 2.03
- d2vida_ appears in SCOPe 2.04
- d2vida_ appears in SCOPe 2.06
- d2vida_ appears in the current release, SCOPe 2.08
View in 3D
