Lineage for d2v8qb1 (2v8q B:190-272)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1948489Fold d.353: AMPKBI-like [160218] (1 superfamily)
    comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions
  4. 1948490Superfamily d.353.1: AMPKBI-like [160219] (1 family) (S)
    automatically mapped to Pfam PF04739
  5. 1948491Family d.353.1.1: AMPKBI-like [160220] (4 proteins)
    Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region
  6. 1948492Protein 5'-AMP-activated protein kinase subunit beta-2 [160223] (1 species)
  7. 1948493Species Human (Homo sapiens) [TaxId:9606] [160224] (1 PDB entry)
    Uniprot O43741 190-272
  8. 1948494Domain d2v8qb1: 2v8q B:190-272 [152782]
    Other proteins in same PDB: d2v8qa1, d2v8qe1, d2v8qe2
    complexed with amp

Details for d2v8qb1

PDB Entry: 2v8q (more details), 2.1 Å

PDB Description: crystal structure of the regulatory fragment of mammalian ampk in complexes with amp
PDB Compounds: (B:) 5'-amp-activated protein kinase subunit beta-2

SCOPe Domain Sequences for d2v8qb1:

Sequence, based on SEQRES records: (download)

>d2v8qb1 d.353.1.1 (B:190-272) 5'-AMP-activated protein kinase subunit beta-2 {Human (Homo sapiens) [TaxId: 9606]}
gqemyafrseerfksppilpphllqvilnkdtniscdpallpepnhvmlnhlyalsikds
vmvlsathrykkkyvttllykpi

Sequence, based on observed residues (ATOM records): (download)

>d2v8qb1 d.353.1.1 (B:190-272) 5'-AMP-activated protein kinase subunit beta-2 {Human (Homo sapiens) [TaxId: 9606]}
gqemyafrseerfksppilpphllqvilnkdtnpnhvmlnhlyalsikdsvmvlsathry
kkkyvttllykpi

SCOPe Domain Coordinates for d2v8qb1:

Click to download the PDB-style file with coordinates for d2v8qb1.
(The format of our PDB-style files is described here.)

Timeline for d2v8qb1: